быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LAT1/SLC7A5 Rabbit mAb (A22292)
- Описание
- Характеристики
-
Overview
Product name LAT1/SLC7A5 Rabbit mAb Catalog No. A22292 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56924 Background
Enables L-leucine transmembrane transporter activity; L-tryptophan transmembrane transporter activity; and thyroid hormone transmembrane transporter activity. Involved in carboxylic acid transport; thyroid hormone transport; and xenobiotic transport. Located in cytosol; intracellular membrane-bounded organelle; and plasma membrane. Is integral component of membrane. Part of amino acid transport complex; apical plasma membrane; and microvillus membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LAT1/SLC7A5 (NP_003477.4). Sequence FAAAKLLALALIILLGFVQIGKGDVSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTL Gene ID Swiss Prot Synonyms E16; CD98; LAT1; 4F2LC; MPE16; D16S469E Calculated MW 55kDa Observed MW 39kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples MCF7, HeLa Cellular location Apical cell membrane, Cytoplasm, Multi-pass membrane protein, cytosol 
Western blot analysis of various lysates, using LAT1/SLC7A5 antibody (A22292) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human placenta using LAT1/SLC7A5 Rabbit mAb (A22292) at dilution of 1:900 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human testis using LAT1/SLC7A5 Rabbit mAb (A22292) at dilution of 1:900 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LAT1/SLC7A5 (NP_003477.4). Isotype IgG