быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SMMHC/MYH11 Rabbit mAb (A22339)
- Описание
- Характеристики
-
Overview
Product name SMMHC/MYH11 Rabbit mAb Catalog No. A22339 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51916 Background
The protein encoded by this gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. It functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. A chromosomal rearrangement involving this gene is associated with acute myeloid leukemia of the M4Eo subtype. Mutations in this gene are associated with visceral myopathy, megacystis-microcolon-intestinal hypoperistalsis syndrome 2, and familial thoracic aortic aneurysm 4.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1). Sequence DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL Gene ID Swiss Prot Synonyms AAT4; FAA4; SMHC; SMMHC; VSCM2; SMMS-1 Calculated MW 227kDa Observed MW 251kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A375, Mouse lung, Mouse uterus, Mouse bone(Low expression control), Rat lung Cellular location Melanosome 
Western blot analysis of various lysates, using SMMHC/MYH11 antibody (A22339) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of A375 cells, using SMMHC/MYH11 antibody (A22339) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1). Isotype IgG