- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name Collagen I/COL1A2 Rabbit mAb Catalog No. A22349 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52125 Background
This gene encodes the pro-alpha2 chain of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIB, recessive Ehlers-Danlos syndrome Classical type, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for the alpha1 chain of type I collagen (COL1A1) reflecting the different role of alpha2 chains in matrix integrity. Three transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen I/COL1A2 (NP_000080.2). Sequence PTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAA Gene ID Swiss Prot Synonyms OI4; EDSCV; EDSARTH2 Calculated MW 129kDa Observed MW 165kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples U-138MG Cellular location Secreted, Extracellular matrix, Extracellular space 
Western blot analysis of various lysates, using Collagen I/COL1A2 antibody (A22349) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Confocal imaging of A-431 cells using Collagen I/COL1A2 Rabbit mAb (A22349, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Confocal imaging of NIH/3T3 cells using Collagen I/COL1A2 Rabbit mAb (A22349, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen I/COL1A2 (NP_000080.2). Isotype IgG







