быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SARS-CoV Spike RBD Rabbit mAb (A22368)
- Описание
- Характеристики
-
Overview
Product name SARS-CoV Spike RBD Rabbit mAb Catalog No. A22368 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52570 Background
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4; APN, aminopeptidase N; CEACAM, carcinoembryonic antigen-related cell adhesion molecule 1; Sia, sialic acid; O-ac Sia, O-acetylated sialic acid. The spike is essential for both host specificity and viral infectivity. The term 'peplomer' is typically used to refer to a grouping of heterologous proteins on the virus surface that function together. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. It's been reported that SARS-CoV-2 (COVID-19 coronavirus, 2019-nCoV) can infect the human respiratory epithelial cells through interaction with the human ACE2 receptor. The spike protein is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion. The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity. The main functions for the Spike protein are summarized as: Mediate receptor binding and membrane fusion; Defines the range of the hosts and specificity of the virus; Main component to bind with the neutralizing antibody; Key target for vaccine design; Can be transmitted between different hosts through gene recombination or mutation of the receptor binding domain (RBD), leading to a higher mortality rate.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of coronavirus SARS-CoV Spike RBD (NP_828851.1). Sequence ADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP Gene ID Swiss Prot Synonyms E2 Calculated MW 139kDa Observed MW 181KD Applications
Reactivity SARS-CoV Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location 
Western blot analysis of 293T, using SARS-CoV Spike RBD antibody (A22368) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity SARS-CoV Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of coronavirus SARS-CoV Spike RBD (NP_828851.1). Isotype IgG







