быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD83 Rabbit mAb (A22379)
- Описание
- Характеристики
-
Overview
Product name CD83 Rabbit mAb Catalog No. A22379 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53759 Background
The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-143 of human CD83 (NP_004224.1). Sequence TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA Gene ID Swiss Prot Synonyms BL11; HB15 Calculated MW 23kDa Observed MW 23-65kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Daudi, Raji, Hela Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of various lysates, using CD83 Rabbit mAb (A22379) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-143 of human CD83 (NP_004224.1). Isotype IgG