быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IKKβ Rabbit mAb (A22425)
- Описание
- Характеристики
-
Overview
Product name IKKβ Rabbit mAb Catalog No. A22425 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0085 Background
The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IKKβ (O14920). Sequence MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQ Gene ID Swiss Prot Synonyms IKK2; IKKB; IMD15; IMD15A; IMD15B; NFKBIKB; IKK-beta Calculated MW 87kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Cellular location Cytoplasm, Membrane raft, Nucleus 
Western blot analysis of extracts of various cell lines, using IKKβ antibody (A22425) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using IKKβ antibody (A22425) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IKKβ (O14920). Isotype IgG