быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cytokeratin 19 (KRT19) Rabbit mAb (A22427)
- Описание
- Характеристики
-
Overview
Product name Cytokeratin 19 (KRT19) Rabbit mAb Catalog No. A22427 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0272 Background
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (KRT19) (P08727). Sequence RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL Gene ID Swiss Prot Synonyms K19; CK19; K1CS Calculated MW 44kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location apicolateral plasma membrane, costamere, cytoskeleton, cytosol, extracellular exosome, plasma membrane, sarcolemma, terminal web, Z disc 
Western blot analysis of extracts of various cell lines, using Cytokeratin 19 (KRT19) (KRT19) antibody (A22427) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human kidney using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using Cytokeratin 19 (KRT19) Rabbit mAb (A22427) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (KRT19) (P08727). KO Validated Validated Isotype IgG