быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SHP2 Rabbit mAb (A22429)
- Описание
- Характеристики
-
Overview
Product name SHP2 Rabbit mAb Catalog No. A22429 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0356 Background
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 502-593 of human SHP2 (Q06124). Sequence SGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR Gene ID Swiss Prot Synonyms CFC; NS1; JMML; SHP2; BPTP3; PTP2C; METCDS; PTP-1D; SH-PTP2; SH-PTP3 Calculated MW 68kDa Observed MW 72kDa Applications
Reactivity Human Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HeLa, 293T, Jurkat, U-251MG Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using SHP2 antibody (A22429) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg SHP2 antibody (A22429). Western blot was performed from the immunoprecipitate using SHP2 antibody (A22429) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 502-593 of human SHP2 (Q06124). Isotype IgG