быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PIM2 Rabbit mAb (A22432)
- Описание
- Характеристики
-
Overview
Product name PIM2 Rabbit mAb Catalog No. A22432 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1485 Background
This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PIM2 (Q9P1W9). Sequence TRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG Gene ID Swiss Prot Synonyms PIM2; serine/threonine-protein kinase pim-2 Calculated MW 34kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications WB IP Recommended dilution - WB 1:500 - 1:2000
- IP 1:50-1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples Cellular location cytoplasm 
Western blot analysis of extracts of various cell lines, using PIM2 Rabbit mAb (A22432) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg PIM2 antibody (A22432). Western blot was performed from the immunoprecipitate using PIM2 (A22432) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PIM2 (Q9P1W9). Isotype IgG