быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
STAT3 Rabbit mAb (A22434)
- Описание
- Характеристики
-
Overview
Product name STAT3 Rabbit mAb Catalog No. A22434 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2576 Background
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT3 (P40763). Sequence MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPME Gene ID Swiss Prot Synonyms APRF; HIES; ADMIO; ADMIO1 Calculated MW 88kDa Observed MW 86kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples Rat brain Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts from Rat brain , using STAT3 Rabbit mAb (A22434) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH/3T3 cells using STAT3 Rabbit mAb (A22434) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg STAT3 antibody (A22434). Western blot was performed from the immunoprecipitate using STAT3 (A22434) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT3 (P40763). Isotype IgG







