быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cyclin B1 Rabbit mAb (A22435)
- Описание
- Характеристики
-
Overview
Product name Cyclin B1 Rabbit mAb Catalog No. A22435 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2614 Background
The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 334-433 of human Cyclin B1 (P14635). Sequence YDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV Gene ID Swiss Prot Synonyms CCNB Calculated MW 48kDa Observed MW 55kDa Applications
Reactivity Human Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples Jurkat Cellular location Cytoplasm, Nucleus, Centrosome, Cytoskeleton, Microtubule Organizing center 
Western blot analysis of Jurkat, using CyclinB1 antibody (A22435) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Cyclin B1 Rabbit mAb (A22435) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg Cyclin B1 antibody (A22435). Western blot was performed from the immunoprecipitate using Cyclin B1 antibody (A22435) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 334-433 of human Cyclin B1 (P14635). Isotype IgG