быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
KRAS+HRAS+NRAS Rabbit mAb (A22438)
- Описание
- Характеристики
-
Overview
Product name KRAS+HRAS+NRAS Rabbit mAb Catalog No. A22438 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2656 Background
This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq, Jul 2008]Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ras (P01111). Sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQI Gene ID Swiss Prot Synonyms C-K-RAS; CFC2; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; KI-RAS; KRAS1; KRAS2; NS; NS3; RALD; RASK2; c-Ki-ras2 Calculated MW 21kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples 293T, MCF7, Mouse lung, Mouse brain, Rat lung, Rat brain Cellular location Cytosol, Extracellular exosome, Golgi apparatus, Plasma membrane 
Western blot analysis of various lysates, using KRAS+HRAS+NRAS antibody (A22438) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH/3T3 using KRAS+HRAS+NRAS Rabbit mAb (A22438) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 using KRAS+HRAS+NRAS Rabbit mAb (A22438) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS using KRAS+HRAS+NRAS Rabbit mAb (A22438) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg KRAS+HRAS+NRAS antibody (A22438). Western blot was performed from the immunoprecipitate using KRAS+HRAS+NRAS antibody (A22438) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ras (P01111). Isotype IgG