быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FBP1 Rabbit mAb (A22441)
- Описание
- Характеристики
-
Overview
Product name FBP1 Rabbit mAb Catalog No. A22441 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2693 Background
Fructose-1, 6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1, 6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1, 6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FBP1 (P09467). Sequence MADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEED Gene ID Swiss Prot Synonyms FBP Calculated MW 37kDa Observed MW 40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse liver, Mouse kidney Cellular location Cytoplasm, Cytosol, Extracellular exosome, Nucleus 
Western blot analysis of various lysates, using FBP1 antibody (A22441) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using FBP1 Rabbit mAb (A22441) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using FBP1 Rabbit mAb (A22441) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using FBP1 Rabbit mAb (A22441) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FBP1 (P09467). Isotype IgG