быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD147/BSG Rabbit mAb (A22443)
- Описание
- Характеристики
-
Overview
Product name CD147/BSG Rabbit mAb Catalog No. A22443 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2742 Background
The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD147/BSG (P35613). Sequence HIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS Gene ID Swiss Prot Synonyms OK; 5F7; TCSF; CD147; EMPRIN; HAb18G; EMMPRIN Calculated MW 42kDa Observed MW 38-58kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HepG2, A-431, Jurkat, Y79 Cellular location Cell membrane, Melanosome, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using CD147/BSG antibody (A22443) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human liver using CD147/BSG Rabbit mAb (A22443) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD147/BSG (P35613). KO Validated Validated Isotype IgG