быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FGF2 Rabbit mAb (A22448)
- Описание
- Характеристики
-
Overview
Product name FGF2 Rabbit mAb Catalog No. A22448 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51103 Background
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF2 (NP_001997.5). Sequence RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE Gene ID Swiss Prot Synonyms BFGF; FGFB; FGF-2; HBGF-2 Calculated MW 31kDa Observed MW 18kDa/22kDa/26kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples SKOV3, Mouse ovary, Mouse spleen, Rat spleen Cellular location Nucleus, Secreted 
Western blot analysis of various lysates, using FGF2 antibody (A22448) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of HeLa using FGF2 Rabbit mAb (A22448) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 using FGF2 Rabbit mAb (A22448) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 using FGF2 Rabbit mAb (A22448) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF2 (NP_001997.5). Isotype IgG