быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
JunD Rabbit mAb (A22466)
- Описание
- Характеристики
-
Overview
Product name JunD Rabbit mAb Catalog No. A22466 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56604 Background
The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human JunD (NP_005345.3). Sequence YAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV Gene ID Swiss Prot Synonyms AP-1 Calculated MW 35kDa Observed MW 38kDa/42kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Jurkat Cellular location nucleoplasm, nucleus 
Western blot analysis of various lysates, using JunD antibody (A22466) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human JunD (NP_005345.3). Isotype IgG