быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cyclin E1 Rabbit PolymAb® (A22476)
- Описание
- Характеристики
-
Overview
Product name Cyclin E1 Rabbit PolymAb® Catalog No. A22476 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51384_ARC51385 Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2, whose activity is required for cell cycle G1/S transition. This protein accumulates at the G1-S phase boundary and is degraded as cells progress through S phase. Overexpression of this gene has been observed in many tumors, which results in chromosome instability, and thus may contribute to tumorigenesis. This protein was found to associate with, and be involved in, the phosphorylation of NPAT protein (nuclear protein mapped to the ATM locus), which participates in cell-cycle regulated histone gene expression and plays a critical role in promoting cell-cycle progression in the absence of pRB.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Cyclin E1 (NP_001229.1). Sequence AASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSG Gene ID Swiss Prot Synonyms CCNE; pCCNE1 Calculated MW 47kDa Observed MW 47kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples MCF7, K-562, Mouse brain, Rat brain Cellular location centrosome, cytoplasm, cytosol, nucleoplasm, nucleus 
Western blot analysis of various lysates, using Cyclin E1 Rabbit PolymAb® (A22476) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Cyclin E1 (NP_001229.1). Isotype IgG







