быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PI3 Kinase p85 alpha/beta Rabbit mAb (A22487)
- Описание
- Характеристики
-
Overview
Product name PI3 Kinase p85 alpha/beta Rabbit mAb Catalog No. A22487 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57210 Background
Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1). Sequence SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT Gene ID Swiss Prot Synonyms PIK3R1/PIK3R2 Calculated MW 42-54kDa/81-84kDa Observed MW 85kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, NIH/3T3, Mouse brain Cellular location cell-cell junction, cis-Golgi network, cytoplasm, cytosol, nucleus, perinuclear region of cytoplasm, plasma membrane 
Western blot analysis of various lysates, using PI3 Kinase p85 alpha/beta antibody (A22487) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1). Isotype IgG