быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
STIM1 Rabbit mAb (A22488)
- Описание
- Характеристики
-
Overview
Product name STIM1 Rabbit mAb Catalog No. A22488 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57102 Background
This gene encodes a type 1 transmembrane protein that mediates Ca2+ influx after depletion of intracellular Ca2+ stores by gating of store-operated Ca2+ influx channels (SOCs). It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region, as well as early hematopoiesis, by mediating attachment to stromal cells. Mutations in this gene are associated with fatal classic Kaposi sarcoma, immunodeficiency due to defects in store-operated calcium entry (SOCE) in fibroblasts, ectodermal dysplasia and tubular aggregate myopathy. This gene is oriented in a head-to-tail configuration with the ribonucleotide reductase 1 gene (RRM1), with the 3' end of this gene situated 1.6 kb from the 5' end of the RRM1 gene. Alternative splicing of this gene results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 530-685 of human STIM1 (NP_003147.2). Sequence RQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK Gene ID Swiss Prot Synonyms GOK; TAM; TAM1; IMD10; STRMK; D11S4896E Calculated MW 77kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications WB IHC-P IP Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HeLa, Jurkat, MCF7 Cellular location cortical endoplasmic reticulum, endoplasmic reticulum, plasma membrane, plasma membrane raft 
Western blot analysis of various lysates, using STIM1 antibody (A22488) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human liver using STIM1 Rabbit mAb (A22488) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human placenta using STIM1 Rabbit mAb (A22488) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg STIM1 antibody (A22488). Western blot was performed from the immunoprecipitate using STIM1 antibody (A22488) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 530-685 of human STIM1 (NP_003147.2). Isotype IgG