быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BCL6 Rabbit mAb (A22610)
- Описание
- Характеристики
-
Overview
Product name BCL6 Rabbit mAb Catalog No. A22610 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57886 Background
The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1). Sequence PKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG Gene ID Swiss Prot Synonyms BCL5; LAZ3; BCL6A; ZNF51; ZBTB27 Calculated MW 79kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IHC-P FC FC(Intra) Recommended dilution - IHC-P 1:500 - 1:1000
- FC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Nucleus 
Western blot analysis of Daudi, using BCL6 Rabbit mAb (A22610) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human tonsil using BCL6 Rabbit mAb (A22610) at dilution of 1:2000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Flow cytometry:1X10^6 HAP1 cells (Low Expression, Left) and Daudi cells (Right) were intracellularly-stained with BCL6 Rabbit mAb(A22610, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb (1:200 dilution) staining.Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 A20 cells were intracellularly-stained with BCL6 Rabbit mAb(A22610, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb (1:200 dilution) staining.Non-fluorescently stained A20 cells were used as blank control (red line).
Flow cytometry:1X10^6 Daudi cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or BCL6 Rabbit mAb(A22610, 2 μg/mL, right).
Flow cytometry:1X10^6 A20 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or BCL6 Rabbit mAb(A22610, 2 μg/mL, right).
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1). Isotype IgG