быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GSDMA Rabbit mAb (A22624)
- Описание
- Характеристики
-
Overview
Product name GSDMA Rabbit mAb Catalog No. A22624 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57560 Background
Predicted to enable phosphatidylinositol-4, 5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Involved in apoptotic process. Located in perinuclear region of cytoplasm.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 61-181 human GSDMA(NP_835465.2). Sequence LDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFF Gene ID Swiss Prot Synonyms GSDM; FKSG9; GSDM1 Calculated MW 49kDa Observed MW 49KD Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:2000 - 1:5000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples COLO 205 Cellular location Cytoplasm, perinuclear region 
Western blot analysis of various lysates, using GSDMA antibody (A22624) at 1:7000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
Immunofluorescence analysis of human skin cells using GSDMA Rabbit mAb (A22624) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 61-181 human GSDMA(NP_835465.2). Isotype IgG