быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Nanog Rabbit mAb (A22625)
- Описание
- Характеристики
-
Overview
Product name Nanog Rabbit mAb Catalog No. A22625 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC58438 Background
The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 153-305 of human Nanog (NP_079141.2) . Sequence WQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV Gene ID Swiss Prot Synonyms NANOG Calculated MW 35kDa Observed MW 37kDa, 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:3000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples NTERA-2, F9, Mouse brain, Rat brain Cellular location Nucleus 
Western blot analysis of various lysates, using Nanog antibody (A22625) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 153-305 of human Nanog (NP_079141.2) . Isotype IgG