быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LRP6 Rabbit mAb (A22661)
- Описание
- Характеристики
-
Overview
Product name LRP6 Rabbit mAb Catalog No. A22661 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54062 Background
This gene encodes a member of the low density lipoprotein (LDL) receptor gene family. LDL receptors are transmembrane cell surface proteins involved in receptor-mediated endocytosis of lipoprotein and protein ligands. The protein encoded by this gene functions as a receptor or, with Frizzled, a co-receptor for Wnt and thereby transmits the canonical Wnt/beta-catenin signaling cascade. Through its interaction with the Wnt/beta-catenin signaling cascade this gene plays a role in the regulation of cell differentiation, proliferation, and migration and the development of many cancer types. This protein undergoes gamma-secretase dependent RIP- (regulated intramembrane proteolysis) processing but the precise locations of the cleavage sites have not been determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human LRP6 (NP_002327.2). Sequence CSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGF Gene ID Swiss Prot Synonyms ADCAD2; STHAG7 Calculated MW 180kDa Observed MW 180kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Mouse lung, Rat colon Cellular location Endoplasmic reticulum, Membrane, Single-pass type I membrane protein 
Western blot analysis extracts from HeLa cells, using LRP6 antibody (A22661) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of various lysates, using LRP6 antibody (A22661) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human LRP6 (NP_002327.2). Isotype IgG