быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GSK-3α/β Rabbit mAb (A22665)
- Описание
- Характеристики
-
Overview
Product name GSK-3α/β Rabbit mAb Catalog No. A22665 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55345 Background
The protein encoded by this gene is a serine-threonine kinase, belonging to the glycogen synthase kinase subfamily. It is involved in energy metabolism, neuronal cell development, and body pattern formation. Polymorphisms in this gene have been implicated in modifying risk of Parkinson disease, and studies in mice show that overexpression of this gene may be relevant to the pathogenesis of Alzheimer disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant protein of human GSK-3α/β（ NP_063937.2） Sequence DPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVF Gene ID Swiss Prot Synonyms GSK3B; gsk-3β Calculated MW 46kDa/48kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:2000 - 1:20000
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples Cellular location Cell membrane, Cytoplasm, Nucleus 
Western blot analysis of various lysates, using GSK-3α/β antibody (A22665) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant protein of human GSK-3α/β（ NP_063937.2） Isotype IgG