быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PKA C-beta (PRKACB) Rabbit mAb (A22721)
- Описание
- Характеристики
-
Overview
Product name PKA C-beta (PRKACB) Rabbit mAb Catalog No. A22721 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57124 Background
The protein encoded by this gene is a member of the serine/threonine protein kinase family. The encoded protein is a catalytic subunit of cAMP (cyclic AMP)-dependent protein kinase, which mediates signalling though cAMP. cAMP signaling is important to a number of processes, including cell proliferaton and differentiation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 251-351 of human PKA C-beta (PRKACB). Sequence IVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF Gene ID Swiss Prot Synonyms CAFD2 Calculated MW 41kDa Observed MW 39-41kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:2000 - 1:20000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T, Mouse brain, Rat brain, Rat testis Cellular location Cell membrane, Cytoplasm, Lipid-anchor, Membrane, Nucleus 
Western blot analysis of various lysates, using PKA C-beta (PRKACB) antibody (A22721) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human testis using PKA C-beta (PRKACB) Rabbit mAb (A22721) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using PKA C-beta (PRKACB) Rabbit mAb (A22721) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of NIH-3T3 cells using PKA C-beta (PRKACB) Rabbit mAb (A22721, dilution 1:200)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 251-351 of human PKA C-beta (PRKACB). Isotype IgG