быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SIRT7 Rabbit mAb (A22735)
- Описание
- Характеристики
-
Overview
Product name SIRT7 Rabbit mAb Catalog No. A22735 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56567 Background
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 301-400 of human SIRT7 (NP_057622.1). Sequence TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKVT Gene ID Swiss Prot Synonyms SIR2L7 Calculated MW 45kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Mouse thymus Cellular location Cytoplasm, Nucleus, nucleolus 
Western blot analysis of HepG2, using SIRT7 antibody (A22735) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of Mouse thymus, using SIRT7 antibody (A22735) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 301-400 of human SIRT7 (NP_057622.1). Isotype IgG