быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IRF7 Rabbit mAb (A22742)
- Описание
- Характеристики
-
Overview
Product name IRF7 Rabbit mAb Catalog No. A22742 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC58459 Background
This gene encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. It has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. The encoded protein plays an important role in the innate immune response against DNA and RNA viruses.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 101-200 of human IRF7 (NP_001563.2). Sequence STRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTAS Gene ID Swiss Prot Synonyms IMD39; IRF-7; IRF7A; IRF7B; IRF7C; IRF7H; IRF-7H Calculated MW 54kDa Observed MW 45, 65kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Raji Cellular location Cytoplasm, Nucleus 
Western blot analysis of Raji, using IRF7 antibody (A22742) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 101-200 of human IRF7 (NP_001563.2). Isotype IgG