быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FAM20A Rabbit mAb (A22760)
- Описание
- Характеристики
-
Overview
Product name FAM20A Rabbit mAb Catalog No. A22760 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC58698 Background
This locus encodes a protein that is likely secreted and may function in hematopoiesis. A mutation at this locus has been associated with amelogenesis imperfecta and gingival hyperplasia syndrome. Alternatively spliced transcript variants have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human FAM20A(NP_060035.2). Sequence AIFDFLIGNMDRHHYEMFTKFGDDGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDR Gene ID Swiss Prot Synonyms AI1G; AIGFS; FP2747 Calculated MW 61kDa Observed MW 59kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:2000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2, A-431 Cellular location Endoplasmic reticulum, Golgi apparatus, Secreted 
Western blot analysis of various lysates, using FAM20A antibody (A22760) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human FAM20A(NP_060035.2). Isotype IgG