быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IL-1 alpha Rabbit mAb (A22766)
- Описание
- Характеристики
-
Overview
Product name IL-1 alpha Rabbit mAb Catalog No. A22766 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC58205 Background
Enables cytokine activity and interleukin-1 receptor binding activity. Involved in positive regulation of angiogenesis and positive regulation of vascular endothelial growth factor production. Acts upstream of or within several processes, including cell surface receptor signaling pathway; connective tissue replacement involved in inflammatory response wound healing; and positive regulation of cytokine production. Located in cytoplasm and extracellular space. Is expressed in several structures, including alimentary system; brain; hemolymphoid system gland; reproductive system; and respiratory system. Human ortholog(s) of this gene implicated in several diseases, including Fabry disease; Schnitzler syndrome; autoimmune disease (multiple); hematologic cancer (multiple); and lung disease (multiple). Orthologous to human IL1A (interleukin 1 alpha).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 115-270 of mouse IL-1 alpha (NP_034684.2). Sequence SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS Gene ID Swiss Prot Synonyms Il-1a Calculated MW 31kDa Observed MW 20-25kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Recombinant Mouse IL-1 alpha Protein Cellular location Nucleus, Secreted, Cytoplasm 
Western blot analysis of Recombinant Mouse IL-1 alpha Protein, using IL-1 alpha antibody (A22766) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 115-270 of mouse IL-1 alpha (NP_034684.2). Isotype IgG







