быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HSPA14 Rabbit mAb (A2286)
- Описание
- Характеристики
-
Overview
Product name HSPA14 Rabbit mAb Catalog No. A2286 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1908 Background
Predicted to enable several functions, including ATP binding activity; misfolded protein binding activity; and unfolded protein binding activity. Predicted to be involved in several processes, including cellular response to unfolded protein; chaperone cofactor-dependent protein refolding; and protein refolding. Located in cytosol. Colocalizes with ribosome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPA14 (Q0VDF9). Sequence MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRY Gene ID Swiss Prot Synonyms HSP70-4; HSP70L1; MSANTD7 Calculated MW 55kDa Observed MW 55kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T, HepG2, Mouse thymus Cellular location Cytoplasm, cytosol 
Western blot analysis of extracts of various cell lines, using HSPA14 Rabbit mAb (A2286) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon using HSPA14 Rabbit mAb (A2286) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using HSPA14 Rabbit mAb (A2286) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPA14 (Q0VDF9). Isotype IgG