быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SRP54 Rabbit mAb (A2296)
- Описание
- Характеристики
-
Overview
Product name SRP54 Rabbit mAb Catalog No. A2296 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1904 Background
Enables several functions, including 7S RNA binding activity; endoplasmic reticulum signal peptide binding activity; and guanyl ribonucleotide binding activity. Contributes to GTPase activity. Involved in granulocyte differentiation and protein targeting to ER. Located in cytosol and nucleus. Part of signal recognition particle, endoplasmic reticulum targeting. Implicated in severe congenital neutropenia 8.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-504 of human SRP54 (P61011). Sequence PGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM Gene ID Swiss Prot Synonyms SCN8 Calculated MW 56kDa Observed MW 56kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Jurkat Cellular location Cytoplasm, Cytosol, Endoplasmic reticulum, Nuclear speck, Nucleus 
Western blot analysis of extracts of various cell lines, using SRP54 antibody (A2296) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of C6 cells using SRP54 Rabbit mAb (A2296) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using SRP54 Rabbit mAb (A2296) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using SRP54 Rabbit mAb (A2296) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-504 of human SRP54 (P61011). Isotype IgG