быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD84 Rabbit mAb (A2299)
- Описание
- Характеристики
-
Overview
Product name CD84 Rabbit mAb Catalog No. A2299 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2570 Background
This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 246-345 of human CD84 (Q9UIB8). Sequence FRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI Gene ID Swiss Prot Synonyms LY9B; hCD84; mCD84; SLAMF5 Calculated MW 39kDa Observed MW 64-82kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, K-562, Mouse spinal cord, Mouse spleen, Mouse thymus, Rat spinal cord Cellular location Cell membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using CD84 antibody (A2299) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 246-345 of human CD84 (Q9UIB8). Isotype IgG