быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Granzyme B Rabbit mAb (A22993)
- Описание
- Характеристики
-
Overview
Product name Granzyme B Rabbit mAb Catalog No. A22993 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55455 Background
This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Granzyme B (NP_004122.2). Sequence YNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFK Gene ID Swiss Prot Synonyms C11; HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1 Calculated MW 28kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IHC-P Recommended dilution - IHC-P 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples HL-60, A-549 Cellular location Cytoplasmic granule 
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Granzyme B Rabbit mAb (A22993) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using Granzyme B Rabbit mAb (A22993) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Granzyme B (NP_004122.2). KO Validated Validated Isotype IgG







