быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Histone H4 Rabbit mAb (A23000)
- Описание
- Характеристики
-
Overview
Product name Histone H4 Rabbit mAb Catalog No. A23000 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57963 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4(NP_003529.1) Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG Gene ID Swiss Prot Synonyms H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A Calculated MW 11kDa Observed MW 11kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:500 - 1:1000
- IF/ICC 1:100 - 1:500
- CHIP 1:50 - 1:200
- ChIP-seq 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, C2C12 Cellular location Chromosome, Nucleus 
Chromatin immunoprecipitations were performed with cross-linked chromatin from Hela cells and Histone H4 mAb (A23000). The ChIP sequencing results indicate the enrichment pattern of Histone H4 in selected genomic region and representative gene loci (GAPDH), as shown in figure.
Western blot analysis of various lysates, using Histone H4 antibody (A23000) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human kidney using Histone H4 Rabbit mAb (A23000) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using Histone H4 Rabbit mAb (A23000) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH/3T3 using Histone H4 Rabbit mAb (A23000) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 using Histone H4 Rabbit mAb (A23000) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.
Chromatin immunoprecipitation analysis of extracts of cells, using Histone H4 antibody (A23000) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4(NP_003529.1) Isotype IgG