быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Glucagon Rabbit mAb (A23029)
- Описание
- Характеристики
-
Overview
Product name Glucagon Rabbit mAb Catalog No. A23029 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56936 Background
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glucagon (NP_002045.1). Sequence MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAE Gene ID Swiss Prot Synonyms GLP1; GLP2; GRPP; GLP-1 Calculated MW 21kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications IHC-P IF/ICC Recommended dilution - IHC-P 1:100 - 1:500
- IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Immunofluorescence Positive samples Cellular location Secreted 
Immunohistochemistry of paraffin-embedded human pancreas using Glucagon Rabbit mAb (A23029) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of mouse pancreas using Glucagon Rabbit mAb (A23029) at dilution of 1:500 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of rat pancreas using Glucagon Rabbit mAb (A23029) at dilution of 1:500 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glucagon (NP_002045.1). KO Validated Validated Isotype IgG







