быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IL4I1 Rabbit mAb (A23151)
- Описание
- Характеристики
-
Overview
Product name IL4I1 Rabbit mAb Catalog No. A23151 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54077 Background
This gene encodes a secreted L-amino acid oxidase protein which primarily catabolizes L-phenylalanine and, to a lesser extent, L-arginine. The expression of this gene is induced by the cytokine interleukin 4 in B cells. This gene is also expressed in macrophages and dendritic cells. This protein may play a role immune system escape as it is expressed in tumor-associated macrophages and suppresses T-cell responses. This protein also contains domains thought to be involved in the binding of flavin adenine dinucleotide (FAD) cofactor. Multiple transcript variants encoding different isoforms have been found for this gene. Some transcripts of this gene share a promoter and exons of the 5' UTR with the overlapping NUP62 gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL4I1. Sequence MAPLALHLLVLVPILLSLVASQDWKAERSQDPFEKCMQDPDYEQLLKVVTWGLNRTLKPQRVIVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRIFT Gene ID Swiss Prot Synonyms LAO; FIG1; LAAO; hIL4I1 Calculated MW 63kDa Observed MW 70kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Human plasma Cellular location Lysosome 
Western blot analysis of Human plasma, using IL4I1 antibody (A23151) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL4I1. Isotype IgG







