быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FLG Rabbit mAb (A23193)
- Описание
- Характеристики
-
Overview
Product name FLG Rabbit mAb Catalog No. A23193 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC60254 Background
The protein encoded by this gene is an intermediate filament-associated protein that aggregates keratin intermediate filaments in mammalian epidermis. It is initially synthesized as a polyprotein precursor, profilaggrin (consisting of multiple filaggrin units of 324 aa each), which is localized in keratohyalin granules, and is subsequently proteolytically processed into individual functional filaggrin molecules. Mutations in this gene are associated with ichthyosis vulgaris.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-92AA of human FLG (NP_002007.1). Sequence MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKIDFTEFLLMVFKLAQAYYESTRKE Gene ID Swiss Prot Synonyms FLG1; ATOD2; FLG-1 Calculated MW 435kDa Observed MW 50kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse stomach, Rat stomach Cellular location Cytoplasmic ribonucleoprotein granule, Cytosol, keratohyalin granule, Nucleus 
Western blot analysis of various lysates, using FLG Rabbit mAb (A23193) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-92AA of human FLG (NP_002007.1). Isotype IgG