быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Glutaredoxin 1 (GLRX) Rabbit mAb (A23246)
- Описание
- Характеристики
-
Overview
Product name Glutaredoxin 1 (GLRX) Rabbit mAb Catalog No. A23246 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC59054 Background
This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 11-106 of human Glutaredoxin 1 (GLRX) (NP_002055.1). Sequence QPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ Gene ID Swiss Prot Synonyms GRX; GRX1 Calculated MW 12kDa Observed MW 12kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, Mouse liver, Rat kidney Cellular location Cytoplasm 
Western blot analysis of various lysates, using Glutaredoxin 1（GLRX） Rabbit mAb (A23246) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 11-106 of human Glutaredoxin 1 (GLRX) (NP_002055.1). Isotype IgG