быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CYP27A1 Rabbit mAb (A23250)
- Описание
- Характеристики
-
Overview
Product name CYP27A1 Rabbit mAb Catalog No. A23250 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC59606 Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 431-530 of human CYP27A1 (NP_000775.1). Sequence VSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQ Gene ID Swiss Prot Synonyms CTX; CP27; CYP27 Calculated MW 60kDa Observed MW 55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:3000 - 1:6000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse liver, Rat liver Cellular location Mitochondrion membrane 
Western blot analysis of various lysates, using CYP27A1 Rabbit mAb (A23250) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 431-530 of human CYP27A1 (NP_000775.1). Isotype IgG







