быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Caspase-1 p20 Rabbit mAb (A23429)
- Описание
- Характеристики
-
Overview
Product name Caspase-1 p20 Rabbit mAb Catalog No. A23429 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC60705 Background
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-1 p20(NP_001244047.1). Sequence DVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG Gene ID Swiss Prot Synonyms ICE; P45; IL1BC Calculated MW 10KDa/29KDa/35KDa/42KDa/45KDa Observed MW 20-25kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples THP-1, THP-1+TPA+LPS Cellular location Cytoplasm, Cell membrane Customer validation WB(Mus musculus)

Western blot analysis of THP-1, using Caspase-1 p20 Rabbit mAb (A23429) at 1:2000 dilution.THP-1 cells were treated by PMA/TPA (80 nM) at 37℃ for overnight and LPS (1 μg/ml) at 37℃ for 6 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-1 p20(NP_001244047.1). Isotype IgG







