быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CCR2/CKR2 Rabbit mAb (A2385)
- Описание
- Характеристики
-
Overview
Product name CCR2/CKR2 Rabbit mAb Catalog No. A2385 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2585 Background
The protein encoded by this gene is a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The encoded protein mediates agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This protein can also be a coreceptor with CD4 for HIV-1 infection. This gene is located in the chemokine receptor gene cluster region of chromosome 3.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR2/CKR2 (P41597). Sequence MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAH Gene ID Swiss Prot Synonyms CKR2; CCR-2; CCR2A; CCR2B; CD192; CKR2A; CKR2B; CMKBR2; MCP-1-R; CC-CKR-2 Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, U-937, Mouse lung, Rat lung Cellular location Cell membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using CCR2/CKR2 antibody (A2385) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of various cell lines, using CCR2/CKR2 antibody (A2385) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR2/CKR2 (P41597). Isotype IgG