быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LEFTY1/2 Rabbit mAb (A2387)
- Описание
- Характеристики
-
Overview
Product name LEFTY1/2 Rabbit mAb Catalog No. A2387 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2149 Background
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. This gene is closely linked to both a related family member and a related pseudogene. [provided by RefSeq, Aug 2016]Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 267-366 of human LEFTY1/2 (O75610). Sequence EMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP Gene ID Swiss Prot Synonyms LEFTB; LEFTYB Calculated MW 34.44kDa Observed MW 41kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HT-29, BxPC-3, Mouse brain, Rat brain Cellular location Extracellular space 
Western blot analysis of extracts of various cell lines, using LEFTY1/2 Rabbit mAb (A2387) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using LEFTY1/2 Rabbit mAb (A2387) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using LEFTY1/2 Rabbit mAb (A2387) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 267-366 of human LEFTY1/2 (O75610). Isotype IgG