быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CRMP1 Rabbit mAb (A2390)
- Описание
- Характеристики
-
Overview
Product name CRMP1 Rabbit mAb Catalog No. A2390 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1918 Background
This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human CRMP1 (Q14194). Sequence GKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNN Gene ID Swiss Prot Synonyms DRP1; DRP-1; CRMP-1; DPYSL1; ULIP-3 Calculated MW 62kDa Observed MW 62kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y, Rat brain Cellular location Cytoplasm, Centrosome, Cytoskeleton, Microtubule organizing center, Spindle 
Western blot analysis of extracts of various cell lines, using CRMP1 Rabbit mAb (A2390) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human CRMP1 (Q14194). Isotype IgG