быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HEC1/NDC80 Rabbit mAb (A2392)
- Описание
- Характеристики
-
Overview
Product name HEC1/NDC80 Rabbit mAb Catalog No. A2392 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0741 Background
This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 543-642 of human HEC1/NDC80 (O14777). Sequence ESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE Gene ID Swiss Prot Synonyms HEC; HEC1; TID3; KNTC2; HsHec1; hsNDC80 Calculated MW 74kDa Observed MW 76kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Jurkat Cellular location Chromosome, Nucleus, centromere, kinetochore 
Western blot analysis of extracts of various cell lines, using HEC1/NDC80 Rabbit mAb (A2392) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 543-642 of human HEC1/NDC80 (O14777). Isotype IgG