быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD335/NKp46 Rabbit mAb (A23950)
- Описание
- Характеристики
-
Overview
Product name CD335/NKp46 Rabbit mAb Catalog No. A23950 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61942 Background
The natural cytotoxic receptor (NCR) family includes NCR1 (NKp46/CD335), NCR2 (NKp44/CD336), and NCR3 (NKp30/CD337). They are type I single Transmembrane protein belonging to the immunoglobulin (Ig) superfamily. Various pathogenic and host coding molecules have been identified as ligands for NCR. They were initially discovered through their ability to induce cytotoxicity of natural killer (NK) cells to tumor cells in vitro, and animal models have shown that NCR plays a role in tumor monitoring, viral infection, and pregnancy in vivo. NCR1/NKP46 is considered a universal marker of NK cells, and recent studies have found that it is also expressed by other cells, such as the first group of natural lymphocytes (ILC1), a subgroup of the third group of ILC (NCR+ILC3), and γδ T cells. NCR1/NKp46 is also expressed in some malignant NK cells, natural killer T (NKT) cells and T-cell lymphoma, and is considered as a diagnostic marker and therapeutic target for them. The cross-linking of NCR1/NKp46 with antibodies can activate NK cells, which has been studied as a promising therapeutic pathway.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-254 of human CD335/NKp46(NP_004820.2). Sequence QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQ Gene ID Swiss Prot Synonyms NCR1; CD335; LY94; NK-p46; NKP46; natural cytotoxicity triggering receptor 1 Calculated MW 21kDa/22kDa/23kDa/32kDa/34kDa Observed MW 35-60kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293F-CD335 Cellular location Cell membrane 
Western blot analysis of various lysates, using CD335/NKp46 Rabbit mAb (A23950) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Confocal imaging of 293F-CD335 and 293F cells using CD335/NKp46 Rabbit mAb (A23950, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-254 of human CD335/NKp46(NP_004820.2). Isotype IgG







