быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
REST/NRSF Rabbit mAb (A2415)
- Описание
- Характеристики
-
Overview
Product name REST/NRSF Rabbit mAb Catalog No. A2415 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0755 Background
This gene was initially identified as a transcriptional repressor that represses neuronal genes in non-neuronal tissues. However, depending on the cellular context, this gene can act as either an oncogene or a tumor suppressor. The encoded protein is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells and it is thought that this repressor may act as a master negative regulator of neurogenesis. Alternatively spliced transcript variants have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human REST/NRSF (Q13127). Sequence KGEPHGLENMELRSLELSVVEPQPVFEASGAPDIYSSNKDLPPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESAEKQAKARE Gene ID Swiss Prot Synonyms WT6; XBR; HGF5; NRSF; DFNA27; GINGF5 Calculated MW 122kDa Observed MW 170kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HeLa, U-87MG, Mouse brain, Rat brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using REST/NRSF Rabbit mAb (A2415) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Rat brain, using REST/NRSF Rabbit mAb (A2415) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunoprecipitation analysis of 300 μg extracts of U-87MG cells using 3 μg REST/NRSF antibody (A2415). Western blot was performed from the immunoprecipitate using REST/NRSF antibody (A2415) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human REST/NRSF (Q13127). Isotype IgG