быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
PE Rabbit anti-Mouse ICOS/CD278 mAb (A24252)
- Описание
- Характеристики
-
Overview
Product name PE Rabbit anti-Mouse ICOS/CD278 mAb Catalog No. A24252 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC62050-PE Background
Predicted to be involved in T cell costimulation; T cell tolerance induction; and cell-cell adhesion. Located in external side of plasma membrane. Is integral component of plasma membrane. Used to study common variable immunodeficiency. Human ortholog(s) of this gene implicated in celiac disease; common variable immunodeficiency; and immunoglobulin alpha deficiency. Orthologous to human ICOS (inducible T cell costimulator).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 21-142 of Mouse ICOS/CD278(NP_059508.2). Sequence EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL Gene ID Swiss Prot Synonyms H4; CCLP; AILIM; CRP-1; Ly115 Calculated MW 22kDa Observed MW Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at 4℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Secreted 
Flow cytometry: 1X10^6 CHO cells(negative control, left) and CHO (Transfection, right) were surface-stained with PE Rabbit anti-Mouse ICOS/CD278 mAb(A24252, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 CHO(Transfection) cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Mouse ICOS/CD278 mAb(A24252, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 21-142 of Mouse ICOS/CD278(NP_059508.2). Isotype IgG