быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NLRP3 Rabbit mAb (A24294)
- Описание
- Характеристики
-
Overview
Product name NLRP3 Rabbit mAb Catalog No. A24294 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC62768 Background
Enables DNA-binding transcription factor binding activity and sequence-specific DNA binding activity. Involved in several processes, including positive regulation of T-helper cell differentiation; positive regulation of cytokine production; and response to bacterium. Acts upstream of or within several processes, including NLRP3 inflammasome complex assembly; activation of cysteine-type endopeptidase activity involved in apoptotic process; and defense response to virus. Located in cytoplasm and nucleus. Part of NLRP3 inflammasome complex. Is expressed in central nervous system and retina. Used to study CINCA Syndrome; familial cold autoinflammatory syndrome 1; and non-alcoholic fatty liver disease. Human ortholog(s) of this gene implicated in CINCA Syndrome; Muckle-Wells syndrome; autosomal dominant nonsyndromic deafness 34; familial cold autoinflammatory syndrome 1; and urticaria. Orthologous to human NLRP3 (NLR family pyrin domain containing 3).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of mouse NLRP3(NP_665826.1). Sequence MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDR Gene ID Swiss Prot Synonyms FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL Calculated MW 118kDa Observed MW 110kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples RAW 264.7+LPS Cellular location Cytoplasm, cytosol, endoplasmic reticulum, extracellular region, inflammasome complex, NLRP3 inflammasome complex, nucleus 
Western blot extracts from RAW 264.7, using NLRP3 Rabbit mAb (A24294) at 1:1000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of mouse NLRP3(NP_665826.1). Isotype IgG