быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
KLF10 Rabbit mAb (A2433)
- Описание
- Характеристики
-
Overview
Product name KLF10 Rabbit mAb Catalog No. A2433 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1921 Background
This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit the growth of cancers, particularly pancreatic cancer. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF10 (Q13118). Sequence MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSD Gene ID Swiss Prot Synonyms EGRA; TIEG; TIEG1; EGR-alpha Calculated MW 53kDa Observed MW 53kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Hep G2, Jurkat, Mouse lung Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using KLF10 Rabbit mAb (A2433) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF10 (Q13118). Isotype IgG