быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ESRα Rabbit mAb (A24421)
- Описание
- Характеристики
-
Overview
Product name ESRα Rabbit mAb Catalog No. A24421 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61898 Background
This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 495-595 of human ESRα (NP_000116.2). Sequence LTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV Gene ID Swiss Prot Synonyms ER Calculated MW 66kDa Observed MW 66kDa Applications
Reactivity Human Tested applications WB IP ChIP Recommended dilution - WB 1:500 - 1:1000
- IP 1:50 - 1:200
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples MCF7 Cellular location Cell membrane, Cytoplasm, Nucleus 
Western blot analysis of various lysates, using ESRα Rabbit mAb (A24421) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Chromatin immunoprecipitation analysis of extracts of MCF7 cells treated by β-estradiol (10 nM, 45 minutes), using ESRα Rabbit mAb(A24421) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR.Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 495-595 of human ESRα (NP_000116.2). Isotype IgG







